SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000006839 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000006839
Domain Number 1 Region: 1348-1546,1573-1598
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.4e-37
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 2 Region: 1011-1166,1204-1283
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.71e-37
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 3 Region: 556-703,737-784
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.26e-30
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 4 Region: 123-267,364-433
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.63e-28
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000006839
Sequence length 1833
Comment SCN4A (Homo_sapiens) sodium channel, voltage-gated, type IV, alpha subunit
Sequence
MARSSLPTLPLGPHCLRPFTRESLAAIEQRAVEEEARLLRNKQMEIEDPEQKPRSDLEAG
KNLPLIFGDPPPEDIDPYYNDKKTFIVLNKGKSIFRFSATPALYMLSPFSIIRRSAIKVL
IHSYPAMFIMITILTNCVFMTMSDPPPWSKNVEYTFTGIYTFESLIKMLARGFCIDNFTF
LRDPWNWLDFSVILMAYVTEFVDLGNISALRTFRVLRALKTITVIPGLKTIVGALIQSVK
KLSDVMILTVFCLSVFALVGLQLFMGNLRQKCIRWPPPFNDTKATWSGNDTWYGNDTWYG
NDTWSHMSWANNYTFDWDAYINDEGNYYFLEGANDALLCGNSSDAGHCPEGYECMKAGRN
PNYGYTSYDTFSWAFLALFRLMTQDYWENLFQLTLRAAGKTYMIFFVVIIFLGSFYLINL
ILAVVAMAYAEQNEATLAEDQEKEEEFQQMLEKFKKQQEELEKAKAAQALEGGEADGDPA
HRKDCNGSLDTSGEKGPPRLSCSADSAISDAMEELEEAHQKCPPWWYKCAHKVLIWNCCT
PWVKFKHIIYLIVMDPFVDLGITICIVLNTLFMAMEHYPMTEHFDNVLSVGNLVFTGIFT
AEMVLKLIALDPYEYFQQGWNIFDSIIVTLSLVELGLANVQGLSVLRSFRLLRVFKLAKS
WPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKIASDCSLPRW
HMHDFFHSFLIIFRILCGEWIETMWDCMEVAGQPMCLTVFLMVMVIGNLVVLNLFLALLL
SSFSADSLAASDEDGEMNNLQIAIGRIKWGIGFAKAFLLGLLHGKILTPKEIMLTLGEPG
GSGEAGEVGDSAPKDKKKEPPPEEEDKDLKDNHILNHVGLPHGPPSSIELDHLNFINNPY
LTIQVPIASEESDLEMPTEEETDTFSEPEDVKKLPQPLYDGNSSVCSTADYKPPEEDPEE
QAEENPEGEQPEECFTEPCVQRFPCLYVDISQDRGKMWWTLRRACFKIVEHNWFETFIVF
MILLSSGALAFEDIYIEQRPVIRTILEYADKIFTYIFIMEMLLKWVAYGFKVYFTNAWCW
LDFLIVDVSIISLVANWLGYSELGPIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPS
IMNVLLVCLIFWLIFSIMGVNLFAGKFYHCINTTTSERFDISEVNNKSECESLMHTGQVR
WLNVKVNYDNVGLGYLSLLQVATFKGWMDIMYAAVDSREQADQPQYEVNLYMYLYFVIFI
IFGSFFTLNLFIGVIIDNFNQQKKKMKGAPLRLMSPIPLYFGGKDIFMTEEQKKYYNAMK
KLGSKKPQKPIPRPQNKIQGLVYDFVTKQVFDITIMILICLNMVTMMVETDDQSQLKVDI
LYNINMIFIIIFTGECVLKMFALRQYYFTIGWNIFDFVVVILSIVGLALSELIQKYFVSP
TLFRVIRLARIGRVLRLIRGAKGIRTLLFALMMSLPALFNIGLLLFLVMFIYSIFGMSNF
AYVKKESGIDDMFNFETFGNSIICLFEITTSAGWDGLLNPILNSGPPDCDPTLENPGTHI
KGNCGNPSIGICFFCSYIIISFLIVVNMYIAIILENFNVATEESSEPLGEDDFEMFYETW
EKFDPDATQFIEYSRLSDFVDTLQEPLKIAKPNKIKLITLDLPMVPGDKIHCLDILFALT
KEVLGDSGEMDALKQTMEEKFMAANPSKVSYEPITTTLKRKHEEVCAIKIQRAYRRHLLQ
RSVKQASYMYRHSQDGSGDGAPEKEGLIANAMSQMYGPENGKTSVQVQGQKEGSTGDTGS
AIGLTPISPSDATLPPSPSPGQTVRPGVKESLV
Download sequence
Identical sequences G5BDI3
HGL_H00000006839

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]