SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000007510 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000007510
Domain Number 1 Region: 395-494,521-588
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.53e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.0000664
Further Details:      
 
Domain Number 2 Region: 602-734
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.49e-37
Family BCR-homology GTPase activation domain (BH-domain) 0.00011
Further Details:      
 
Domain Number 3 Region: 271-359
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-17
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 4 Region: 175-256
Classification Level Classification E-value
Superfamily PX domain 0.000000012
Family PX domain 0.012
Further Details:      
 
Domain Number 5 Region: 114-168
Classification Level Classification E-value
Superfamily PX domain 0.00000017
Family PX domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000007510
Sequence length 1229
Comment ARHGAP33 (Homo_sapiens) Rho GTPase activating protein 33
Sequence
MTSGSVLFERELLWIVTSGHISVSRRNDGDWLYERRDSDPARSTDSLDGPGEGSVQPVPP
TGGPSVKGKPGKRLSAPRGPFPRLADCAHFHYENVDFGHIQLLLSPEREGPSLSGENELV
FGVQVTCQGRSWPVLRSYDDFRSLDAHLHRCIFDRRFSCLPELPPPPEGARAAQGRSWPV
LRSYDDFRSLDAHLHRCIFDRRFSCLPELPPPPEGARAAQMLVPLLLQYLETLSGLVDSN
LNCGPVLTWMELDNHGRRLLLSEEASLNIPAVAAAHVVKRYTAQAPDELSFEVGDIVSVI
DMPPTEDRSWWRGKRGFQVGFFPSECVELFTERPGSGLKADGDGPLCGIPAPQGNSSLTS
AVPRPRGKLAGLLRTFMRSRPSRQRLRQRGILRQRVFGCDLGEHLSNSGQDVPQVLRCCS
EFIEAHGVVDGIYRLSGVSSNIQRLRHEFDSERIPELSGPAFLQDIHSVSSLCKLYFREL
PNPLLTYQLYGKFSVSKGADKVGGYGVHLAQPYHACPQSQEAMSVPGEEERLVRVHDVIQ
QLPPPHYRTLEYLLRHLARMARHSANTSMHARNLAIVWAPNLLRHEFDSERIPELSGPAF
LQDIHSVSSLCKLYFRELPNPLLTYQLYGKFSEAMSVPGEEERLVRVHDVIQQLPPPHYR
TLEYLLRHLARMARHSANTSMHARNLAIVWAPNLLRSMELESVGLGGAAAFREVRVQSVV
VEFLLTHVEVLFSDTFTSAGLDPAGRCLLPRPKSLASSGPSTRLLTLEEAQARTQGRLGT
PTEPTTRKAAASPVERRKRERGEKQRKPGGSSWKTFFALGRGPSIPRKKPLPWLGGSRAP
PQPSGSRPDTVTLRSAKSEESLSSQASGAGLQRLHRLRRPHSSSDAFPVGPAPAGSCESL
SSSSSSSSSSSSSSSSSSESSAAGLGPLSGSPSHRTSAWLDDGDELDFSPPRCLEGLRGL
DFDPLTFRCSSPTPGDPAPPASPAPPAPASAFPPRATPKAPSPRGPTSPASSTALDISEP
LAVSVPPAVLELLGAGGTPASVTPTPALSPGPGLRPHLIPLLLHGSEAQLSDTCHQEISS
KLALPGPRGTQAQHVESCSAHPTLSQTLKLPQDPADPIPIPFCVGPSVDSPLLPPPLSLL
RPGRAPPPPPKNPARLMALALAERAQQVAERQSQQEHASTPTTPHSPFCRSLSLEGSPAC
PDLCTAGGGYSSYSSLPMHPTKPSDKVNE
Download sequence
Identical sequences G5BXN7
HGL_H00000007510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]