SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000020926 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000020926
Domain Number 1 Region: 341-474
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.27e-26
Family Synaptotagmin-like (S variant) 0.00062
Further Details:      
 
Domain Number 2 Region: 208-339
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.42e-23
Family Synaptotagmin-like (S variant) 0.000000868
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000020926
Sequence length 484
Comment SYT13 (Homo_sapiens) synaptotagmin XIII
Sequence
MSPRCQAPPELGPQVTPYMCLPLDKLVHPRLHRAAFTRQEKARKPVYIRPAEDGSLCTPQ
GFQKRVLAAGISSLLTQRSLGTYRGDLLLLLLLLPELATGTKRDVAGAQQIHGPRSFSHF
NVKKSTEPVQPRPLLKFPDIYGPRPAVTAPEVINYADYTLGTTEEAAAPISPQPLSDSRL
KRQVTEELFILPQNGVVEDVCVMETWNPEKAASWNQAPKLHYCLDYDRQKAELFVTCLEA
LTSDHDGGCDCYVQGSVAITTGSVEAQTALKRRQQHTAWEEGLVLPLAEEELRTAALTLT
LRTCDRFSRHSVAGELRLALDGVSVPLGAAQWGELKTSVKEPSSGTGEVLLSISYLPAAN
RLLVVLIKAKNLHSNQSKVLLGKDVSVKVTLKHQAQKLKKKQTKRAKHKINPVWNEMIMF
ELPDDLLRASSVELEVLSQDEAGQSCTLGHCSLGLHTSGSERSHWEEMLKNPRRQIAMWH
QLCQ
Download sequence
Identical sequences G5AS52
HGL_H00000020926

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]