SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000033079-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000033079-1
Domain Number 1 Region: 18-212
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.45e-41
Family BCR-homology GTPase activation domain (BH-domain) 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000033079-1
Sequence length 587
Comment FAM13B (Homo_sapiens) family with sequence similarity 13, member B
Sequence
MRKSSSPSLSNCNSILANKIFGIPLDELQPGGQPDNEVPFIVCHVVDYIEEHGSLEQQGL
FQVNGNAETVEWLQQRYDSGEEVDLVKEADVPSAISLLRFFLQELPEPVIPGSWHILLIH
LSQDYNNEDEFGRKLRFLLQQLPPVNYSLLKFLCRFLANVASHHEEIWSANSLAAVFGPD
VFHIYTDVEDMKEQEIGSRIMAGLLENYYEFFENEEVNDLSEEEEDEKLERIEELPEEGA
EKSNNMPEVVQLRMTENILESNSVIASTSAHMSPTSILPASAEVDAADGIINASDSSKEC
SEPVAGANFNNEVMQQDTVFEDEENQTMKVKQVRMNPEPFRRRKKPPKEATLEFILKKLK
EKRVERCLPEDIKKMTKDHLVEEKTSLQKILLSYESQHGCLVTREERNIVKPRCDRYRLV
KQMLTRASITPLLGSPSTKRGGQMLQPIIEGETAQFFEEIKEEEDGISLSSKLNILKTAI
QAQSSLENSESDIKENQKLALDLRLSSTRAASMPELLEQLWKARAEKKKLRKTLCEFEEA
FYQQNGRNTQKEDPVPVLEEYREYKKIQAKLRLLEVLISKQDSSKSI
Download sequence
Identical sequences G5ALF3
HGL_H00000033079-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]