SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000085068 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000085068
Domain Number 1 Region: 10-191
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 3.53e-48
Family Isochorismatase-like hydrolases 0.0000874
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000085068
Sequence length 204
Comment ISOC2 (Homo_sapiens) isochorismatase domain containing 2
Sequence
MAAARPGLGRILPGSSILFLCDMQEKFRHSIAYFPEVVAVAARMLRASRLLEVPAVLTEQ
YPQGLGPTVPELGAEGLPALSKTCFSMVPAVQQELDSRPQLQSVLLCGIEAQACILNTAL
DLLDRGLQVHVVVDACSSRSQVDRLVALGRMRQSGAFLSTSEGLILQLVGDASHPRFKEI
QKIIKEPAPDSGLLGLFQGQKPLF
Download sequence
Identical sequences G5BVZ0
HGL_H00000085068 XP_004866702.1.39548 XP_012921808.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]