SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000095634 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000095634
Domain Number 1 Region: 412-469
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 2 Region: 356-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.54e-22
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 300-357
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.04e-17
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 458-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-16
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 5 Region: 263-314
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000123
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 6 Region: 182-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000238
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 7 Region: 62-116
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000379
Family KRAB domain (Kruppel-associated box) 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000095634
Sequence length 512
Comment ZNF275 (Homo_sapiens) zinc finger protein 275
Sequence
MCGAKRGRVSDSGDDEARRPSRGGQGAAVKGRNRGSAEAYAVLRRTLLGRRLDGKPGYPW
EFFQGLVPSGDAVQYLTEREWLKLDPEQRTLAYYGHVTSVGVPILHPTLTSHLAQGQVLL
VSDPSLSTEQAKRPESTSVTCHRRMGEETQPQEMTSVSSPRADDPRAEGRGGCPQDLPIE
HHFACKECGATFRLKVLLVQHQRVHSEEKGWECGDCRKVFRGAAEFNAHRQSHVAAEPRP
GPSWALEDAKAERREQLEREAMPFECEECGKRFKKNAGLSQHLRVHSREKPFDCEECGRS
FSAHTHLFQHQKLHTAEKPFACKACSRDFLDRQELLKHQRVHTGHLPFDCDDCGKSFRAV
NGLAEHQRIHSGSKPYGCLHCGKLFRRSSELTKHRRIHTGEKPYECDECGKAFRQSSGLL
EHARIHSGERPYMCGECGKAFRGPSDLIKHRRIHSGLRPYECDKCGKAFLRSSGLSRHQR
IHSGARRCVCSECGRVFKRRSALQKHQPTHRE
Download sequence
Identical sequences G5B4W5
HGL_H00000095634

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]