SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000160373 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000160373
Domain Number 1 Region: 684-842,880-930
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.95e-56
Family Ankyrin repeat 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000160373
Sequence length 1635
Comment CTTNBP2 (Homo_sapiens) cortactin binding protein 2
Sequence
KKEFDVDTLSKSELRMLLSVMEGELEARDLVIEALRARRKEVFIQERYGRFNLNDPFLAL
QRDYEAGAGDKEKKPVCTNPLSILEAVMAHCRKMQERMSTQLAAAESRQKKLEMEKLQLQ
ALEQEHKKLAARLEEEREKNKQVVLMLAKECKQLSGRVIEEAQKLEEVMTKLEEEKKKTN
ELEEELSAEKRRSTEMEAQMEKQLSEFDTEREQLRAKLNREEAHTTNLKEEIDKMKKMIE
QLKRGSDSKPSLSLPRKTKDRHLVSISVGTEGPVTESVACQTDLLTESTDHVKKVPLTMP
VKPSAGSPLISANAKGNVCTSAPLVRPGIDRQASHGDLVSSSQPTLPPPGTSRIEENGPS
SGSMPDLSSSTPSLPSSSTPPTAQTPGPTPQTYSQAPPMHSLHSPCANASLHAGLNPRIQ
AARFRFQGNVNDPDQNGNTTQSPPSRDISPTSRDSLVAKQLARNTVTQALSRFTSPQASA
PPRLGAASAGDGGTHPPVGRASLKTPGIPRVDRGNPPPIPPKKPGLSQTPSPPHPQLKVI
MDSSRASNAGAKVDNKSVVSSPSSLPQGNRVTNEENAPKSSSPQLPPKPSIDLTVAPTGC
TVSALATSQVGAWPAEVPGLSQPACSDSSLVVPTTIAFCSSISPVSASSHRPGASDSLLV
TASGWSPSLTPLLMSGGPAPLAGRPTLLQQAAAQGNVTLLSMLLNEEGLDINYSCEDGHS
ALYSAAKNGHTDCVRLLLNAEAQVNAADKNGFTPLCAAAAQGHFECVELLIAYDANINHA
AAGGQTPLYLACKNGNRECIKLLLEVGTDRSAKTRDGWTPVHAAVDTGNEESLKLLMFHR
TPAHGNSQSEEEPEPAFCALDGGEESPEDTSKPVVPADLINHADREGWTAAHIAASKGFK
NCLEILCRHGGLEPEKRDKCNRTVHDVATDDCKHLLENLNALKIPLRLSVGEIQPGNYDC
DDFECENTICALNIRKQTSWDDFSKAVSQALTNHFQAISSDGWCSLEDMTFNNTTDSNIG
LGASSVRSITLGNVPWPASQSCTQSLWDFVKKNKAEHVTVYLSGPLEGCLSSVTYASMIP
LQVLQNYLRLVEQYHNVVFHGPEGSLQDYIAYQLALCLKHRQMAAGYSCDIVRAEVDASF
SKEHLVDLFISSACLIPVKQSPVKKKIIIILENLERSSLSELLGDFLAPLENRNTESPWT
FQKGNGTSECYYFHENCFLMGTITKACLQGPDLVVQQHFRWVQLRWDCEPMQGLLQRFLR
RKVVNKFRGQVPSPSDPTCRIVDWVLCVWRQLNSCLAHLGTPEALLGPKHFLSCPIVPGH
AQATVKWMSKLWNAIIAPRVQEAILSRASVKRQPGLGQTAAKKHPSQGQQAVVKAALSIL
LNKAVLHGCPLPRAELGQHTADFKGGSFPLSIVSSYSKKKGEKSGAWRKVNTSPRKKPSR
FSAPPWHKLDQSREGIKNMTISQLNCDRNASLSKQKSLENDLSLTLTLDPRLSLGSDDET
DLVKELQSMCSSKSESDISKIADSRDDLRRFDNSGNNSEFSATVNNPEMPASPKETRPPS
SHQTTECSNSKSKTESGVSRVKSFLPVPRSKAGQCSQNTKRSSSSSNTRQLEINNNSKEE
NWYLHKHEQVEKPNK
Download sequence
Identical sequences G5B3Q6
HGL_H00000160373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]