SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000173527 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000173527
Domain Number 1 Region: 41-225
Classification Level Classification E-value
Superfamily Isochorismatase-like hydrolases 7.2e-51
Family Isochorismatase-like hydrolases 0.0000449
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000173527
Sequence length 232
Comment ISOC1 (Homo_sapiens) isochorismatase domain containing 1
Sequence
XFVVQLFAEEWGQYVDLPKGFAVSERCKLRLVPLQIQLTTLGNLTPSSTVFFCCDMQERF
RPAIKYFGDIISVGQRLLQGARILGIPVIVTEQYPKGLGSTVQEIDLTGVKLVLPKSKFS
MVLPEVEAALAEIPGVRSVVLFGVETHVCIQQTALELVGRGIEVHIVADATSSRSMMDRM
FALERLARTGIIVTTSEAVLLQLVADKDHPKFKEIQNLIKASAPESGLLSKV
Download sequence
Identical sequences HGL_H00000173527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]