SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000194900 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000194900
Domain Number 1 Region: 539-726
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.53e-59
Family Nucleotide and nucleoside kinases 0.000000153
Further Details:      
 
Domain Number 2 Region: 273-372
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-33
Family PDZ domain 0.0000283
Further Details:      
 
Domain Number 3 Region: 375-489,532-566
Classification Level Classification E-value
Superfamily SH3-domain 1.06e-31
Family SH3-domain 0.0000956
Further Details:      
 
Domain Number 4 Region: 120-215
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-27
Family PDZ domain 0.0000226
Further Details:      
 
Domain Number 5 Region: 14-119
Classification Level Classification E-value
Superfamily PDZ domain-like 3.15e-27
Family PDZ domain 0.0000933
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000194900
Sequence length 730
Comment DLG3 (Homo_sapiens) discs, large homolog 3 (Drosophila)
Sequence
ASSAPLLVNPEALESSLSVNGSDGMFKYEEIVLERGNSGLGFSIAGGIDNPHVPDDPGIF
ITKIIPGGAAAMDGRLGVNDCVLRVNEVDVSEVVHSRAVEALKEAGPVVRLVVRRRQPPP
ETIMEVNLLKGPKGLGFSIAGGIGNQHIPGDNSIYITKIIEGGAAQKDGRLQIGDRLLAV
NNTNLQDVRHEEAVASLKNTSDMVYLKVAKPGSLHLNDMYAPPDYASTFTALADNHISHN
SSLGYLGAVESKVSYPAPPQAPPTRYSPIPRHMLAEEDFTREPRKIILHKGSTGLGFNIV
GGEDGEGIFVSFILAGGPADLSGELRRGDRILSVNGVNLRNATHEQAAAALKRAGQSVTI
VAQYRPEEYSRFESKIHDLREQMMNSSMSSGSGSLRTSEKRSLYVRALFDYDRTRDSCLP
SQGLSFSYGDILHVINASDDEWWQARLVTPHGESEQIGVIPSKKRVEKKERARLKTVKFH
ARTGMIESNRDFPGLSDDYYGAKNLKGVTSNTSDSESSSKGQEDAILSYEPVTRQEIHYA
RPVIILGPMKDRVNDDLISEFPHKFGSCVPHTTRPRRDNEVDGQDYHFVVSREQMEKDIQ
DNKFIEAGQFNDNLYGTSIQSVRAVAERGKHCILDVSGNAIKRLQQAQLYPIAIFIKPKS
IEALMEMNRRQTYEQANKIYDKAMKLEQEFGEYFTAIVQGDSLEEIYNKIKQIIEDQSGH
YIWVPSPEKL
Download sequence
Identical sequences G5B6C6
HGL_H00000194900

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]