SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000198765 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000198765
Domain Number 1 Region: 137-259
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.22e-22
Family Synaptotagmin-like (S variant) 0.048
Further Details:      
 
Domain Number 2 Region: 288-492
Classification Level Classification E-value
Superfamily vWA-like 2.97e-19
Family Integrin A (or I) domain 0.024
Further Details:      
 
Domain Number 3 Region: 13-131
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.03e-18
Family Synaptotagmin-like (S variant) 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000198765
Sequence length 533
Comment CPNE3 (Homo_sapiens) copine III
Sequence
MAAQCVTKVELNISCNNLLDLDATSKSDPLCVLFLNTSGQQWYEVERTERIKNCLNPKFS
KTFIIDYYFEVVQKLKFGIYDIDNKTVELSDDDFLRECECTLRQIVSSKKLTQPLVLKND
KPAWKGNIMISAEEIKDNRVVLFEMQARKLDNKDLFGKSDPYLEFHKQTSDGNWLIVHGT
EVIKNNLNPVWKPFKISLNSLCYGDMDKTIKVECYDYDSDGSHDLIGTFQTTMTKLKEAS
RNSPIEYECINEKKKQKKKSYKNSGVISVKHCEITVECTFLDYIMGGCQLNFTVGVDFTG
SNGDPRSPDSLHYISPNGVNEYLTAIWSVGQVIQDYDADKLFPAFGFGAQIPPQWQVSHE
FPMNFNPSNPYCNGVQGIVEAYRACLPQIKLYGPTNFSPIINHVARFAAAATQQQTASQY
FVLLIITDGVITDLDETRQAIINAAKLPMSIIIVGVGGADFGAMEFLDGDGGSLRSLNGE
VAIRDIVQFVPFRQFQNAPKEALAQCVLAEIPQQVVGYFNTYKLLPPRNPATK
Download sequence
Identical sequences G5BPJ9
HGL_H00000198765

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]