SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000202556 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000202556
Domain Number 1 Region: 889-1012
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.06e-25
Family Ankyrin repeat 0.0000007
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.5e-24
Family Ras-binding domain, RBD 0.0074
Further Details:      
 
Domain Number 3 Region: 1017-1079
Classification Level Classification E-value
Superfamily SH3-domain 6.96e-19
Family SH3-domain 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000202556
Sequence length 1088
Comment PPP1R13B (Homo_sapiens) protein phosphatase 1, regulatory (inhibitor) subunit 13B
Sequence
MILTVFLSNNEQILTDVPITPETTCRDVVEFCKEPGEGGCHLAEVWRGNERPIPFEHMMY
EHLQKWGPRREEVKFFLRHEDSPTESSEQGGRQTQEQRTQRNVINVPVERRTENGVGNPR
VELTLSELQDMAARQQQQIENQQQMLVAKEQRLHFLKQQERRQQQSISENEKLQKLKERV
EAQENKLKKIRAMRGQLDYSKVMNGSLSAEIERFSAMFQEKKQEVQTAILRVDQLSQQLE
DLKKGKLNGFQSYNGKLTGPAAVELKRLYQELQIRNQLNQEQNSKLQQQKELLNKRNMEV
AMMDKRISELRERLYGKKIQACARETLNRVNGTSSPQSPLSTSSRVAAVGPYIQVPSGGS
HPVPGDPVKPQSLTVASSAAHGRSKSANDGNWPTLKPNSGSSGKPAQMASTDWKESGVEG
ALKQGAISSQPLPLSALGTTEKLGIEIGKGPPPMPGIGKPLPPSYGTYPSPTPQGPGSTS
SLERRKDSSLPRPGAGLPSRQKPALLPPAASTPQPGSSQQIQQRISVPPSPTYPPAGPPS
FPPGDGKPELPLTVAIRPFLADKGSRPQSPRKGPQTVNSSSIYSMYLQQATPPKNYQPAV
HGTLNKSVKAVYGKPVLASGSTSPSPLPFLHGSSQPQPSSECAEKEPEPEGPTAPGEGST
VESLPRPLSPTKLTPIVHSPLRYQSDADLEALRRKLANAPRPLKKRSSITEPEGPGGPNI
QKLLYQRFNTLAGGMEGTPFYQPSPSQDFVGTLADMDNGNTNANGNLDEPSPAQPTGPLL
SEPIPSSDANDNELPSPEPEELICPQTTHQTAEPTEDNNNNVAPVPSTEQIGSPVAEPPS
PVEEQVPPAALAPVLHPPAASASKRTNLKKPNSERTGHGLRVRFNPLALLLDASLEGEFD
LVQRIIYEVEDPSKPNDEGITPLHNAVCAGHHHIVKFLLDFGVNVNAADSDGWTPLHCAA
SCNSVHLCKQLVESGAAIFASTISDIETAADKCEEMEEGYIQCSQFLYGVQEKLGVMNKG
VVYALWDYEAQNSDELTFHEGDAITILRRKDESETEWWWARLGDREGYVPKNLLGLYPRI
KPRQRTLA
Download sequence
Identical sequences G5AWH7
HGL_H00000202556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]