SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000202816 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000202816
Domain Number - Region: 311-362,403-431
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0321
Family Canonical RBD 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000202816
Sequence length 822
Comment ESF1 (Homo_sapiens) ESF1, nucleolar pre-rRNA processing protein, homolog (S. cerevisiae)
Sequence
MSSKQEIMNDQRFRKVSKDPRFWEMPEKDRKVKIDKRFRAMFHDKKFKLNYAVDKRGRPI
NHSTTEDLKRFYELSDSDSDLSDEDSKPLNQQKIKKKNRQTKKEIDSKNIIEEKKETKKI
NQKYPGNDLDDSERIQEMKSSKKIDSEISPKKDSKELTQEGTKGKKSIIEHNRDSFPKRK
LKTDPSTSKTVQPPKISCSKTEREKQSVVPVIIGDSDANVSDKDVLEEDSDNADESDEES
EVEITGGGRASADGGSEDEDSEDDDESDSGPDLARGKGNIETSSEDEDDLADLFPEEPGF
EHAWRELDKDAPRANEITHRLAVCNMDWDRLKAKDLLALFNSFKPKGGVIFSVKIYPSEF
GKERMKEEQVQGPVELLSIPEDAPEKDWTSREKLRDYQFKRLKYYYAVVDCDSPETASKI
YEDCDGLEFESSCSFIDLRFIPDDITFDDEPKDIASEVDLTAYKPKYFTSAAMGTSTVEI
TWDETDHERITTLNRKFKKEELLDMDFQAYLASSSEDEELIEEEPQDNDEVSGEDDGKAK
KSQKDDEEQIAKYRQLLQVIQEKEKKGKENDMEMEIKWVPGLKESAEEMVKNKLEGKDKL
TPWEQFLEKKKEKKRLKKKQKALAEEASEDELPPDVDFNDPYFAEEVKKIGLKKKSMKSA
KNATSPEEEIEIERQKAEMALLVMDEEEDSKKHFNYNKIVEHQNLSKKKKKQLMKKKELL
EDDFEVNVSDARFQAMYTSHLFNLDPSDSNFKKTKAMEKILQEKARQRERKEQEIIQAIK
KKESEIEKVSQKKSIDPALSVLIKSVKNKTEQFQARKKQRVK
Download sequence
Identical sequences G5ALV3
HGL_H00000202816 XP_004840889.1.39548 XP_004840890.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]