SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000203556 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000203556
Domain Number 1 Region: 540-756
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.24e-49
Family BCR-homology GTPase activation domain (BH-domain) 0.0000657
Further Details:      
 
Domain Number 2 Region: 88-359
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.63e-36
Family FCH domain 0.031
Further Details:      
 
Domain Number 3 Region: 478-533
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000262
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000203556
Sequence length 965
Comment GMIP (Homo_sapiens) GEM interacting protein
Sequence
PGLPPAPEGRKRYSDIFRSLDNLEISLGNVNFEVLAGDTALLEDPEPGKAPPATVTSDAS
HWGRPSSEGPVPLTGEELDLRLIRTKGGVDAVLEYAKMWSRYAKELLAWTEKRASYELEF
TKNIMKIAEAGKASIQQQSHMPLQYIYTLFLEHDSNLGAQALETLAQQKRDYYQPLAAKR
TEVEKWRKEFKEQWLKEQKRMNEAVQALRRAQLQYTQRCEDLRTRLQGSPEDLAPQGSPG
PSKQQERRRRSREEAQVKAQEAEALYQACVREANARQQDLETAKQRIVSHVRKLVLQGDE
VLRRVTLVLFGLHRKQAERGPRSFAALAECCAPFEPGQRYQEFVRTLQPEAPPPPPPAFS
FQEFAPNRYSFPLDTRKKLSGPPPPRLDESSAEPGPWEDAGAAWPGTLGPAPGTDVDSVG
GGSESRSVDSPTSSPGSSTRRLMKVASTGTESSDDFEDRDPDLGDGLENGLGVPFRKWTP
SIAAQTHRLRRLRGPAKCRECEAFMVSGTECEECFLTCHKRCLETLLILCGHRRLPARTP
LFGVDFLQLPRDFPEEVPFVVTRCTAEIELRALGPWPSPRPQGIYRVSGSRVRVERLCQA
FENGRALVELSGNSPHDVTGVLKRFLQELTDPVVPFHFYDAFISLAKTLHADPGDSPGTP
SPSPEVIRSLKTLLGQLPDSNYNTLRHLVAHLFRVAMQFEENKMSANNLGIVFGPTLLRP
PNCPRAPSASPVTCLLDSAHQAQLVEFLIEHYEQIFGMDELPLATEALPQDPSSAPGPLT
TSPGPVPTPAPQPPALAKDLGPDLKCPSAPEKPSEATPSEATPSEATPSQSDQREGEAED
SKDRAGEVPSQGPEDSLLGTQSRGHFSRQPVKYPRGGVRPVTQHLSGLALVASKLCEEAP
VLAAPGGSLRATPSREGSPLHRTPLAKNFKITQETAQLLSKLDSKAVPRVTCCPDPQPEE
AEVHL
Download sequence
Identical sequences G5AN48
HGL_H00000203556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]