SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000206380 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000206380
Domain Number - Region: 68-121
Classification Level Classification E-value
Superfamily 2-methylcitrate dehydratase PrpD 0.0301
Family 2-methylcitrate dehydratase PrpD 0.1
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000206380
Sequence length 280
Comment TMEM101 (Homo_sapiens) transmembrane protein 101
Sequence
MLLPAALEDARAQVAEASGQSAVCGPQGGRKAIPATGLREETGRVTLAGKCTTPVTVRSL
LLSVAEQARKPDIPVPYLYFDMGAAVLCASFMSFGVKRRWFALGAALQLGVSTYAACVGG
HVHYGHWLKVRMYSRTLAIIGGFLVLASGAGELYRRKPRSRSLQSTGQVFLGIYLICVAY
SLQHSEEDRLAYLNCLPGGELMVQLFFLLYGVLALAFLSGYYVALAAQILAVLLPPVMLL
IDGNVTYWHHTVRVEFWNQMKLLGENMGIFGAAIILATDG
Download sequence
Identical sequences G5BN76
HGL_H00000206380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]