SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for HGL_H00000215375 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000215375
Domain Number 1 Region: 38-120
Classification Level Classification E-value
Superfamily Epsilon subunit of F1F0-ATP synthase N-terminal domain 3.01e-21
Family Epsilon subunit of F1F0-ATP synthase N-terminal domain 0.00000773
Further Details:      
 
Domain Number 2 Region: 123-167
Classification Level Classification E-value
Superfamily Epsilon subunit of F1F0-ATP synthase C-terminal domain 1.2e-17
Family Epsilon subunit of F1F0-ATP synthase C-terminal domain 0.00022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000215375
Sequence length 168
Comment ATP5D (Homo_sapiens) ATP synthase, H+ transporting, mitochondrial F1 complex, delta subunit
Sequence
MLSATLLRRLGLGHLVRQARAYAEAASAPAPAAGPAQMSFTFASPTQVFFNRANVRQVDV
PTLTGAFGILASHVPTLQVLRPGLVVVHAEDGTTTKYFVSSGSVTVNADSSVQLLAEEAV
TLDMLDLGTARANLEKAQSELSGAADEASRAEIQIRIEANEALVKALE
Download sequence
Identical sequences G5AZL3
HGL_H00000215375

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]