SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000215912 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000215912
Domain Number 1 Region: 3-111
Classification Level Classification E-value
Superfamily Kringle-like 3.38e-21
Family Kringle modules 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000215912
Sequence length 263
Comment PIK3IP1 (Homo_sapiens) phosphoinositide-3-kinase interacting protein 1
Sequence
MLLAWVQTFFLSNMLLAEAYGSGGCFWDHGHLYREDQPSPAPGLRCLNWLDAQGGLGSAL
ELGYGNHNYCRNPDRDPRGPWCYVSGEAGTPEKVPCQDARCPETTSQAPPAFTTEPEEMS
EVPGDDEVQVFAPANTLPVRSEAAAVQPVIGISQRVRMNSKEKKDLGTLGYVLGITMMVI
IIAIGAGIILGYTYKRGKDLKEQHDQKVCEREMQRITLPLSAFTNPTCEIVDERTVVVHS
NQTPVDLQEGSTPLIGEAGTPGA
Download sequence
Identical sequences G5BBU8
XP_004843537.1.39548 HGL_H00000215912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]