SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000215941-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000215941-1
Domain Number 1 Region: 16-79
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000000218
Family Ankyrin repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000215941-1
Sequence length 145
Comment ANKRD54 (Homo_sapiens) ankyrin repeat domain 54
Sequence
MMVWTPVVWTPKAAPLLHFASCNGNDQIVQLLLDHRADPNQRNGMGNTLLHLVACTNHFS
VITTLLRGGARMDALHLAKSKRNNLQEGHSQCLEAVVLEVKQIIHSEDLCTRLQMTSAKE
QVDEVTNLPASFTSLSLQMQNMEKR
Download sequence
Identical sequences G5AKL7
HGL_H00000215941-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]