SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000216117 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000216117
Domain Number 1 Region: 94-306
Classification Level Classification E-value
Superfamily Heme oxygenase-like 2.36e-66
Family Eukaryotic type heme oxygenase 0.0000000387
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000216117
Sequence length 374
Comment HMOX1 (Homo_sapiens) heme oxygenase (decycling) 1
Sequence
MKRVGDLFRAKPLALVPRWKVTCSTPLLHRDDWGPGIPGLVGAVFAELRVEPRARPRSLP
TLPRFGDPVVWSTWWALHPTNALTDPTLHRAPQDLSEAIKETTRDVHTQAENTEFMRNFQ
KGQVTREGFKLVMASLYHVYVALEEEIERIRDSQVFAPVYFPEELHRRLALEQDMAFWYG
PRWRHTIPCSPATSRYVQRIHEVGRMEPELLVAHTYTRYLGDLSGGQVLKRIAQKALGLP
GSGEGLAFFTFPGIPNATKFKQLYRARMNSLEMTPEVRRRVLQEAKAAFHACALVFQLFE
ELQGLLTPELQDQSPPQTLGLHHRASSQVQDSSPAEAPLSKAPLPSHVPAPLLPWVLTLL
SFLVATVAVGLYAL
Download sequence
Identical sequences G5BPF0
HGL_H00000216117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]