SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000216181 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000216181
Domain Number 1 Region: 54-835
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.06e-292
Family Motor proteins 1.8e-16
Further Details:      
 
Domain Number 2 Region: 836-961
Classification Level Classification E-value
Superfamily Myosin rod fragments 5.84e-22
Family Myosin rod fragments 0.00034
Further Details:      
 
Domain Number 3 Region: 956-1072
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.22e-20
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 4 Region: 1241-1349
Classification Level Classification E-value
Superfamily Myosin rod fragments 4.45e-18
Family Myosin rod fragments 0.0027
Further Details:      
 
Domain Number 5 Region: 1514-1627
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000218
Family Myosin rod fragments 0.001
Further Details:      
 
Domain Number 6 Region: 1060-1151
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000012
Family Myosin rod fragments 0.0041
Further Details:      
 
Domain Number 7 Region: 1349-1450
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000000523
Family Myosin rod fragments 0.01
Further Details:      
 
Weak hits

Sequence:  HGL_H00000216181
Domain Number - Region: 1850-1937
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000497
Family Myosin rod fragments 0.017
Further Details:      
 
Domain Number - Region: 1613-1827
Classification Level Classification E-value
Superfamily Tropomyosin 0.0216
Family Tropomyosin 0.001
Further Details:      
 
Domain Number - Region: 27-60
Classification Level Classification E-value
Superfamily Myosin S1 fragment, N-terminal domain 0.0573
Family Myosin S1 fragment, N-terminal domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000216181
Sequence length 1974
Comment MYH9 (Homo_sapiens) myosin, heavy chain 9, non-muscle
Sequence
MAQQAADKYLYVDKNFINNPLAQADWAAKKLVWVPSDKSGFEPASLKEEVDEEAIVELVE
NGKKVKVNKDDIQKMNPPKFSKVEDMAELTCLNEASVLHNLKERYYSGLIYTYSGLFCVV
INPYKNLPIYSEEIVEMYKGKKRHEMPPHIYAITDTAYRSMMQDREDQSILCTGESGAGK
TENTKKVIQYLAHVASSHKSKKDQGELERQLLQANPILEAFGNAKTVKNDNSSRFGKFIR
INFDVNGYIVGANIETYLLEKSRAIRQAKEERTFHIFYYLLSGAGEHLKTDLLLEPYNKY
RFLSNGHVTIPGQQDKDMFQETMEAMRIMGIPEEEQMGLLRVISGVLQLGNIVFKKERNT
DQASMPDNTAAQKVSHLLGINVTDFTRGILTPRIKVGRDYVQKAQTKEQADFAIEALAKA
TYERMFRWLVLRINKALDKTKRQGASFIGILDIAGFEIFDLNSFEQLCINYTNEKLQQLF
NHTMFILEQEEYQREGIEWNFIDFGLDLQPCIDLIEKPAGPPGILALLDEECWFPKATDK
SFVEKVMQEQGTHPKFQKPKQLKDKADFCIIHYAGKVDYKADEWLMKNMDPLNDNIATLL
HQSSDKFVSELWKDVDRIIGLDQVAGMSETALPGAFKTRKGMFRTVGQLYKEQLAKLMAT
LRNTNPNFVRCIIPNHEKKAGKLDPHLVLDQLRCNGVLEGIRICRQGFPNRVVFQEFRQR
YEILTPNSIPKGFMDGKQACVLMIKALELDSNLYRIGQSKVFFRAGVLAHLEEERDLKIT
DVIIGFQACCRGYLARKAFAKRQQQLTAMKVLQRNCAAYLKLRNWQWWRLFTKVKPLLQV
SRQEEEMMAKEEELVKVREKQLAAENRLTEMETLQSQLMAEKLQLQEQLQAETELCAEAE
ELRARLTAKKQELEEICHDLEARVEEEEERCQHLQTEKKKMQQNIQELEEQLEEEESARQ
KLQLEKVTTEAKLKKLEEDQIIMEDQNCKLAKEKKLLEDRIAEFTTNLMEEEEKSKSLAK
LKNKHEAMITDLEERLRREEKQRQELEKXRRKLEGDSTDLSDQIAELQAQIAELKMQLAK
KEEELQTALARVEEEAAQKNLAVKKIRELESQVSELQEDLESERASRNKAEKQKRDLGEE
LEALKTELEDTLDSTAAQQELRSKREQEVNILKKTLEEEARTHEAQIQEMRQKHSQAVEE
LAEQLEQTKRVKATLEKAKQSLESERGELANEVKVLLQGKGDLEHKRKKVEAQLQELQVK
FNEGERVRTELADKVTKLQVELDNVTGLLNQSDSKSSKLTKDFSALESQLQDTQELLQEE
NRQKLSLSTKLKQMEDEKNSFKEQLEEEEEAKHNLEKQIATLQAQVTDMKKKMEDGVGCL
ETAEEAKRKLQKDLEGLSQRHEEKVAAYDKLEKTKTRLQQELDDLLVDLDHQRQSVSNLE
KKQKKFDQLLAEEKTISAKYAEERDRAEAEAREKETKALSLARALEEAMEQKAELERLNK
QFRTEMEDLMSSKDDVGKSVHELEKSKRALEQQVEEMKTQLEELEDELQATEDAKLRLEV
NLQAMKAQFERDLQGRDEQSEEKKKQLVRQVREMEAELEDEKKQRSVAVAARKKLEMDLK
DLEAHIDTANKNREEAIKQLRKLQAQMKDCMRELDDTRASREEILAQAKENEKKLKSMEA
EMIQLQEELAAAERAKRQAQQERDELADEIANSSGKGALALEEKRRLEARIAQLEEELEE
EQGNTELINDRLKKANLQIDQINTDLNLERSHAQKNENARQQLERQNKELKVKLQEMESS
VKSKYKASITALEAKIAQLEEQLDNETKYVPPPPPPPGAQRQSFWRGXXQVRRAEKRLKD
VLLQVDDERRSAEQYKDQADKASTRLKQLKRQLEEAEERGPGANASRRKLQRELEDATET
ADAMNREVSSLKNKLRRGDMPFVVPRRMARKGAGDCSDEEVDGKVDGAEAKPAE
Download sequence
Identical sequences HGL_H00000216181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]