SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000216727-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000216727-1
Domain Number 1 Region: 49-160
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.49e-26
Family Canonical RBD 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000216727-1
Sequence length 189
Comment PABPN1 (Homo_sapiens) poly(A) binding protein, nuclear 1
Sequence
ELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEERMEADARSIYVG
NVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLF
RGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRA
RATSWYSPY
Download sequence
Identical sequences G5ASL4
HGL_H00000216727-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]