SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000217185 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000217185
Domain Number 1 Region: 167-434
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.33e-80
Family Protein kinases, catalytic subunit 0.000000176
Further Details:      
 
Domain Number 2 Region: 73-206
Classification Level Classification E-value
Superfamily SH2 domain 4.15e-34
Family SH2 domain 0.0000138
Further Details:      
 
Domain Number 3 Region: 11-94
Classification Level Classification E-value
Superfamily SH3-domain 4.01e-19
Family SH3-domain 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000217185
Sequence length 446
Comment PTK6 (Homo_sapiens) PTK6 protein tyrosine kinase 6
Sequence
MASQGQPHSGPKYMGLWDFEARTDEELSFRAGDLFHVARKEDQWWWATLLDDLGQALEEG
YVPHNYLVEKETMESEPWFFGHISRSEATHRLQAEGSSLGTFLIRVSEQSGADYVLSVRD
AQAVRHYRIWQHKGGRLHLNEAVSFSSLLELVDYHKAQSLRPGLRLTHQAEPLPHWADWE
RPREEFTLCRKLGAGYFGEVFEGLWKGQVRVAIKVISRDNLLHQHTFQSEIQAMKKLRHK
HILALYAVASSGDPVYIITELMPKGNLLQLLRDSEKQALPVSELVDVASQVGKGMCYLES
QNYIHRDLAARNILVGENNICKVGDFGLARLIKEDIYLSHDHKIPYKWTAPEALSRGHYS
IKSDVWSFGILLHEIFSRGQTPYPGMSNREAFLRVDAGYRMPCPLECPPNVHQLMRSCWS
RDPEQRPCFKALCEKLSGLARYEDLL
Download sequence
Identical sequences G5C8D1
HGL_H00000217185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]