SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000217958-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000217958-2
Domain Number 1 Region: 14-177
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.01e-46
Family Ankyrin repeat 0.0000000336
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000217958-2
Sequence length 177
Comment PSMD10 (Homo_sapiens) proteasome (prosome, macropain) 26S subunit, non-ATPase, 10
Sequence
MEGCVSNLMVCNLAYSGKLEELKESILANKSLATRTDQDSRTALHWACLPGHTEIVEFLL
QLSVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASINRHE
IAVMLLEEGGANPDAKDHYEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPL
Download sequence
Identical sequences G5ALZ5
HGL_H00000217958-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]