SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000218364 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000218364
Domain Number 1 Region: 257-347
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.1e-22
Family Canonical RBD 0.00000993
Further Details:      
 
Domain Number 2 Region: 110-217
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1e-16
Family Canonical RBD 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000218364
Sequence length 728
Comment HTATSF1 (Homo_sapiens) HIV-1 Tat specific factor 1
Sequence
MSGSNLNKNDEFDEQLRMQELYGDTKDSDTENDPSEETESFGQQAADTPYEWDLDKKAWF
PKITEDFIATYQANYGFCSDGASSSTAHVPDTSMRTAKDLPQGKTPEPTEPRKKGEKRKG
WFHVEEDRNTNVYVSGLPPDITVDEFIQLMSKFGIIMRDPQTEEFKVKLYKDNQGNLKGD
GLCCYLKRESVELALKLLDEDEIRGYKLHVEVAKFQLKGEYDASKKKKKCKDYKKKLSVQ
QKQLDWRPERRAGPSRMRHERVVILKNMFHPTDFEDDPLVLNEIRDDLRVECSKFGQIKK
LLLFDRHPDGVASVSFRDPEEADHCIQTLDGRWFGGRQITAQPWDGTTDYQVEETARERE
ERLKGWEAFLSTPEANRGLRRSDSVSASEMAGPSRMRHFSEGPSTLKMNAQEAETGMVFE
EPINEKKFEKTEDGGEFEEDAYEEDTKEGELEKESKDDCPEKESEEGCPEREAGGDCPEK
EFEEGSPGKELKKNGSKRESKKRLKKGDEESSLANKSEVDDADKESKGESSPQKESEXXX
DSEKESDEDCLEKQSENSSENSSEKELEENGVKQDFDEDGSDKELRKXXEDSEREFDEES
DEKDEEETYEKVFDDESDEKEDEEDVDGKWHEDADVKEEDDTDEKLFEDSDEKEDKEDAD
GKEGEDVDEKLFEDDNSLEKFDEEESSIEKIFDDSDERGTLENVKEEGLLSTGSSLFLSS
DDDSDDDI
Download sequence
Identical sequences HGL_H00000218364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]