SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000219066 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000219066
Domain Number 1 Region: 92-296
Classification Level Classification E-value
Superfamily DNA-glycosylase 1.05e-58
Family Endonuclease III 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000219066
Sequence length 298
Comment NTHL1 (Homo_sapiens) nth endonuclease III-like 1 (E. coli)
Sequence
MEVQTRISSGTGMAGERLYSGEQAGDDASQAAESRKSHRPVKRQRKAQRLHVAYEDSHGE
KSEGAEPLAVTVWEPQDWCQQLANIRTMRNRKDAPVDQLGAEHCCDPSAPPKVQRYQVLL
ALMLSSQTKDQVTAGAMQRLRAQGLTVNRILQTDDNTLGKLIYPVGFWRSKVKFIKQTSA
ILQQRYDGDIPASLAELVALPGVGPKMAHLAMAVAWGTVSGIAVDTHVHRIANRLRWTRR
MTKSPEETRAALEEWLPRELWHEINGLLVGFGQQICLPIHPRCQACLNQALCPAAQSL
Download sequence
Identical sequences G5BY48
HGL_H00000219066

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]