SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000219069 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000219069
Domain Number 1 Region: 34-125
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 8.7e-38
Family SCAN domain 0.0000417
Further Details:      
 
Domain Number 2 Region: 471-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.16e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 584-641
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.6e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 197-253
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.77e-21
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 5 Region: 155-206
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.55e-20
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 6 Region: 238-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.5e-19
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 7 Region: 630-682
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.8e-18
Family Classic zinc finger, C2H2 0.0022
Further Details:      
 
Domain Number 8 Region: 434-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.67e-18
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 9 Region: 1-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.1e-16
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 10 Region: 376-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000199
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000219069
Sequence length 684
Comment ZNF263 (Homo_sapiens) zinc finger protein 263
Sequence
MASFPGSQEREGLLIVKLEEDCAWSQELPPPDPGPSPEASHLRFRRFRFQEAAGPREALC
RLQELCHGWLRPEMRTKEQILELLVLEQFLTILPQEIQSRVQELHPESGEEAVTLVEDMQ
RELGRLRQQVTNQGRGTEVLLEEPLPLETAGESPSFKLEPVETERSPGPRLQELLGPSPQ
RDPQAVKDRALSAPWLSLFPPEGNMEDKEMTGSQLPESLEDVAMYISQEEWGHQDPSKRT
LSRDTIQESYENVDSLEPHIPSQELLTTQVEQGGKPWDPSVQSCKEAMSPRSPAPGEEKF
ENQEGNIQSVSPENTHPQMLLPGQARGEVPWSPEQGCPHDRAEGHWEPPPEDGMEQSLAG
ATSCRELGPPKELLTKKLHLCPLCGKNFSNNSNLIRHQRIHAAERLCMGVECSEIFSGHP
HFLSLHRAHMGEEAHKCLECGKCFSQNTHLTRHQRTHTGEKPYQCNVCGKSFSCNSNLHR
HQRTHTGEKPYKCSECGEIFAHSSNLLRHQRIHTGERPYKCAECGKSFSRSSHLVIHERT
HERERHDPFSDNGEAMSDGTPFLTNQGTHRAEKKLFECLTCGKSFRQGMHLTRHQRTHTG
EKPYKCTLCGENFSHRSNLIRHQRIHTGEKPYTCHECGDSFSHSSNRIRHLRTHTGERPY
KCSECGESFSRSSRLVSHQRTHTG
Download sequence
Identical sequences G5B1H9
HGL_H00000219069

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]