SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000220809 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000220809
Domain Number 1 Region: 296-558
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 3.32e-84
Family Eukaryotic proteases 0.00000000453
Further Details:      
 
Domain Number 2 Region: 102-208
Classification Level Classification E-value
Superfamily Kringle-like 1.47e-32
Family Kringle modules 0.00016
Further Details:      
 
Domain Number 3 Region: 211-299
Classification Level Classification E-value
Superfamily Kringle-like 1.57e-29
Family Kringle modules 0.0000272
Further Details:      
 
Domain Number 4 Region: 33-81
Classification Level Classification E-value
Superfamily FnI-like domain 1.78e-20
Family Fibronectin type I module 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000220809
Sequence length 560
Comment PLAT (Homo_sapiens) plasminogen activator, tissue
Sequence
MRQELLCVLLLCGAISTLPSQKTHTRFRRGARSYRVTCRDEKTQMTYQQHESWLRPLLRG
NRVEFCWCNGGRPQCHSVPVKGCSEPRCFNGGTCRQALYFSDFVCQCPEGFMGKRCEIDA
RATCYKDQGISYRGTWSTAQSGAECVNWNSSVLALKPYSARRPGAIKLGLGNHNYCRNPD
KDSKPWCYVFKAGKYTSEFCSTPACSKGKNEDCYFRNGSAYRGTQSLTMSGASCLPWDSV
ILRGRGYTAWRFNSQALGLGRHNYCRNPDGDAKPWCHVLKDRKLTWEYCDLPQCSTCGLR
QYQQPQFRIKGGLYSDIASHPWQAAIFIGNKRLQEDRFLCGGVLISSCWVLSAAHCFLER
YSPHLLKVVLGRTYREVPGEEEQKFEVEKYILHKDFHEDTYDNDIALLHLRSDSLHCAQE
SATVRTACLPAADLQLPDWTECELSGYGKHEASSPFYSEQLKEAHVRLYPSSHCTSQHLF
NKTVTHNMLCAGDTRSGGNQANLHDACQGDSGGPLVCMKDKRMTLVGIISWGIGCGQKDV
PGVYTKVTNYLTWIQDNMQP
Download sequence
Identical sequences G5BT55
HGL_H00000220809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]