SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000221327-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000221327-1
Domain Number 1 Region: 318-375
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 2-61
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.1e-23
Family KRAB domain (Kruppel-associated box) 0.00091
Further Details:      
 
Domain Number 3 Region: 402-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.45e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 252-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.14e-21
Family Classic zinc finger, C2H2 0.0022
Further Details:      
 
Domain Number 5 Region: 365-397
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000122
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  HGL_H00000221327-1
Domain Number - Region: 202-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0932
Family Classic zinc finger, C2H2 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000221327-1
Sequence length 473
Comment ZNF180 (Homo_sapiens) zinc finger protein 180
Sequence
LQTLVTFKDVLLDFTREEWKLLDAAQQIMYKDVMLENYKNLVSLGHQLPKPDMILRLEKG
EEPWLMEKGIYHGTYPETIAEIKSSVSRNSISKDKQSCGIKVERVSRNDLRYLSLEDVWK
SEDQLGKYQESQERHMRKVAFTKKKVFIQEKACESSKYEERCLFPTQLVLREYFHRCGSH
TKSLKHDLLFNGHQENCAGNNNECGQTLCQNIHVIQFAQTHIRDKSYKCPDNDSTLVPGA
SLGASKGIHREKPYECKDCGKFFSWRSNLTRHQLIHTGEKPYACKECGKSFSRSSHLIGH
QKTHAGEEPYECKECGKSFSWFSHLITHQRIHTGDKLYTCNQCGKAFVHSSRLIRHQRTH
TGEKPYECPECGKSFRQSTHLILHQRTHVRVRPYECNECGKSYSQRSHLVVHHRIHTGLK
PFKCKDCGKCFSRSSHLFSHQRTHTGEKPYECHDCGKSFSQSSALIVHQRIHT
Download sequence
Identical sequences G5ANU8
HGL_H00000221327-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]