SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000221327-2 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000221327-2
Domain Number 1 Region: 504-561
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.11e-27
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 364-421
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.65e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 560-617
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.83e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 420-477
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 326-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.87e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 6 Region: 602-654
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.37e-21
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 7 Region: 467-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000102
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 8 Region: 41-102
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000128
Family KRAB domain (Kruppel-associated box) 0.011
Further Details:      
 
Domain Number 9 Region: 257-308
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000243
Family Classic zinc finger, C2H2 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000221327-2
Sequence length 665
Comment ZNF180 (Homo_sapiens) zinc finger protein 180
Sequence
LEGSMEERDEKPPRPLKAYEQDXPQEIIIKVEGEDAGPLTAPSHEGVNFKIVTVDFTHED
QGTWNPAVRTPDRGVTLENHRDLVSWDLATAFGRRESTLKQGIFDEELSHGVKIEKLTRD
DPWLSSCDEVHGCKDQLEKQQEKQERLFQEEEFTQRKAIIHKRICKSDESKEKNAANSSL
LSLPMVPIKTHFHKCVSHVKKLQPDSVVNRLQKTNDSDELCENNECGKLPQSIHLIQFTR
TQKRDKSYKFSDSIKCFSQATPININEKIHSGGKSFDFKECGEVLNHELSLNEQQRIPLE
ESQYKCSKISQNSSIAQNMRNQSEEKPFECNQCGKSFSWSSHLVAHQRTHTGEKPYECNE
CGKSFSRSSHLVSHQRTHTGEKPYRCNQCGKSFSQSYVLVVHQRTHTGEKPYECNQCGKS
FRQSYKLIAHQRTHTGEKPYECSQCGKSFIQSYKLIAHQRIHTGEKPYECNQCGKSFSQS
YKLVAHQRTHTGEKPFECNQCGKSFSWSSQLVAHQRTHTGEKPYECNECGKSFNRSSHLV
MHQRTHTGEKPYECNQCGKSFSQSYVLVVHQRTHTGEKPYECNQCGKSFRQSSCLTQHQR
THTGEKPYECSQCGKTFSLSARLIVHQRTHTGEKPFTCNQCGKAFINSSKLLRHQATHNE
EKPHE
Download sequence
Identical sequences HGL_H00000221327-2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]