SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000221419 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000221419
Domain Number 1 Region: 28-126
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.09e-19
Family Canonical RBD 0.0000621
Further Details:      
 
Domain Number 2 Region: 287-380
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.33e-16
Family Canonical RBD 0.0061
Further Details:      
 
Domain Number 3 Region: 137-230
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000163
Family Canonical RBD 0.00034
Further Details:      
 
Domain Number 4 Region: 408-486
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000787
Family Canonical RBD 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000221419
Sequence length 539
Comment HNRNPL (Homo_sapiens) heterogeneous nuclear ribonucleoprotein L
Sequence
MPSSRAQWADAILDSRKLGLIFVFFSQENYDDPHKTPASPVVHIRGLIDGVVEADLVEAL
QEFGPISYVVVMPKKRQALVEFEDVLGACNAVNYAADNQIYIAGHPAFVNYSTSQKISRP
GDSDDSRSVNSVLLFTILNPIYSITTDVLYTICNPCGPVQRIVIFRKNGVQAMVEYPLLR
NSAQRAKASLNGADIYSGCCTLKIEYAKPTRLNVFKNDQDTWDYTNPNLSGQAHFINLGS
GLCNAIGLPVDMGEGIGVTLAVTPTNAKGSPLSWEITLQNMRLKLQPPPPPEYGPHADSP
VLMVYGLDQSKMNCDRVFNVFCLYGNVEKVKFMKSKPGAAMVEMADGYAVDRAITHLNNN
FMFGQKMNVCVSKQPAIMPGQSYGLEDGSCSYKDFSESRNNRFSTPEQAAKNRIQHPSNV
LHFFNAPLEVTEENFFEICDELGVKRPTSVKVFSGKSERSSSGLLEWESKSDALETLGFL
NHYQMKNPSERSSSGLLEWESKSDALETLGFLNHYQMKNPNGPYPYTLKLCFSTAQHAS
Download sequence
Identical sequences G5AMA4
HGL_H00000221419

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]