SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000221444 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000221444
Domain Number 1 Region: 107-302
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.97e-52
Family Voltage-gated potassium channels 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000221444
Sequence length 360
Comment KCNA7 (Homo_sapiens) potassium voltage-gated channel, shaker-related subfamily, member 7
Sequence
MEQSTRAQRVLWDREAQSAEQDPSRLELGTGLQGTTPSGSSGSFRFPVVEENPSGGPWAV
TGGTCSAVCSCQREPRMGQPPGRWQSPLQFPARLNGSSLVPGPPPRLPFNDPFFVVETLC
IFWFSFELLVRLLACPSKAIFFKNVMNLIDFVAILPYFVALGTELARQRGVGQPAMSLAI
LRVIRLVRVFRIFKLSRHSKGLQILGQTLRASMRELGLLIFFLFIGVVLFSSAVYFAEVD
SVESHFTSIPESFWWAVVTMTTVGYGDMAPVTVGGKIVGSLCAIAGVLTISLPVPVIVSN
FSYFYHRETEGEEAGMYSHVDTQPCINLEGKANGGLVDGEVPELPPPLWVPPGKHLVTEV
Download sequence
Identical sequences G5BAF8
HGL_H00000221444

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]