SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000222254 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000222254
Domain Number 1 Region: 580-685
Classification Level Classification E-value
Superfamily SH2 domain 1.27e-31
Family SH2 domain 0.00000331
Further Details:      
 
Domain Number 2 Region: 311-408
Classification Level Classification E-value
Superfamily SH2 domain 5.39e-22
Family SH2 domain 0.0000276
Further Details:      
 
Domain Number 3 Region: 6-82
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000106
Family SH3-domain 0.00014
Further Details:      
 
Domain Number 4 Region: 104-199
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000000011
Family BCR-homology GTPase activation domain (BH-domain) 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000222254
Sequence length 695
Comment PIK3R2 (Homo_sapiens) phosphoinositide-3-kinase, regulatory subunit 2 (beta)
Sequence
MAGTQGFQERALSPFRRERPEDLELLPGDMLVVSRAALQALGVAEGGERCPNSVGWMPGF
NERTRQRGDFPGTYVEFLGPVALARPGPRPRGPRPLPARPRDEPQEPGLTLPDLPEQFAP
PDMAPPILARLVEAIEQTGLDTESHCRPELPALRTDWSLSDLDQWDAGALSDAIKGFLLA
LPAPLVTPEAAAEAHRALRGDGPAFVPAHPAPRVLRGLVFPRAFMRHLLHAPSVLVSAPL
ACTHARAAARSPSPPPSLRTEPSQDFPVLLAEKLLQEHLEEQEAAPPALPPKPSKPKPAA
PGLANGGSPPSLQDAEWYWGDISREEGNEKLRDTPDGTFLVRDASSKIQGEYTLTLREPL
TFRSVVDLITHYRHESLAPYNAQLDMTLLYPVSRLQQDQVVKEDSVEAVGAQLKVYHQQY
QDKSREYDQLYEEYTRTSQELQMKRTAIEAFNETIKIFEEQGQTQERCSKEYLERFRREG
NEKEMQRILLNSERLKSRIAEIHESRTKLEQDLRAQASDNREIDKRMNSLKPDLLQLRKI
RDQYLVWLTQKGARQKKINEWLGIRNETEDQYALMEDEEDLPHHEERTWYVGKINRTQAE
GMLSGKRDGTFLIRESSQRGCYACSVVVDGDTKHCVIYRTATGFGFAEPYNLYGSLKELV
LHYQHASLVQHNDALTVTLAHPVRAPGPGPPPPGR
Download sequence
Identical sequences G5B4D6
HGL_H00000222254

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]