SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000222390 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000222390
Domain Number 1 Region: 584-811
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.65e-58
Family Eukaryotic proteases 0.0000000142
Further Details:      
 
Domain Number 2 Region: 115-208
Classification Level Classification E-value
Superfamily Kringle-like 8.22e-36
Family Kringle modules 0.00000659
Further Details:      
 
Domain Number 3 Region: 210-294
Classification Level Classification E-value
Superfamily Kringle-like 7.73e-34
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 4 Region: 392-475
Classification Level Classification E-value
Superfamily Kringle-like 1.76e-31
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 5 Region: 470-570
Classification Level Classification E-value
Superfamily Kringle-like 9.42e-29
Family Kringle modules 0.00039
Further Details:      
 
Domain Number 6 Region: 36-125
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 8.63e-22
Family Hairpin loop containing domain 0.00000611
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000222390
Sequence length 819
Comment HGF (Homo_sapiens) hepatocyte growth factor (hepapoietin A; scatter factor)
Sequence
MWAARLLQALLLQQVLLHLLLLPVAIPYAEGQKKRRNTLHEFKKSAKTTLIKEDPLLKIK
TKKMNSADQCANRCTRNKGLPFTCKAFVFDKARKRCLWLPFNSMSNGVKKEFGHEFDLYE
KKDYIRNCIIGKGDSYKGTVSVTKSGIKCQPWSSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSKPEVRHEVCDIPQCSEVECMTCNGESYRGPMDHTESGKTCQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCRLMIVSSAPLKV
EKVGDGPIFGQCHPCLTYGFTENGSVVGIWIVSGWYLRKMLKKNGLIIKRTEVTQTQYGG
KRIEMTKGDKEIHEKISGAHSTMNDTDVPMETTECLQGQGEGYRGTVNSIWNGIPCQRWD
SQYPHQHDITPENFKCKDLRENYCRNPDGAESPWCFTTDPNIRVGYCSQIPRCDVARGQD
CYRGNGKNYMGSLSKTRSGLTCSMWARNMEDLHRHIFWEPDASKLNKNYCRNPDDDAHGP
WCYTGNPLIPWDYCPISRCEGDTTPTINLDHPVISCAKTKQLRVVNGIPARTNVGWMVSL
KFRNKHICGGSLIKESWVLTARQCFPARNRDLKDYEAWLGIHDVHGRGEEKRRQVRNVSQ
LVFGPEGSDLVLLKLARPAVLDDSVSTVDLPNYGCAIPESTTCSVYGWGYTGAISADGLL
RVAHLHVVGPEQCARHHRGKVTLSEAELCAGPEKGGSGPCEGDYGGPLICEQHKMRMVLG
VIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS
Download sequence
Identical sequences G5B0R1
HGL_H00000222390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]