SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000222553-4 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000222553-4
Domain Number 1 Region: 132-293
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 0.00000000000000353
Family NadC C-terminal domain-like 0.072
Further Details:      
 
Weak hits

Sequence:  HGL_H00000222553-4
Domain Number - Region: 32-56,96-131
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 0.0235
Family NadC N-terminal domain-like 0.015
Further Details:      
 
Domain Number - Region: 69-101
Classification Level Classification E-value
Superfamily DUSP-like 0.0484
Family DUSP, domain in ubiquitin-specific proteases 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000222553-4
Sequence length 300
Comment NAMPT (Homo_sapiens) nicotinamide phosphoribosyltransferase
Sequence
MVVTHYKQYPPNTSKVYSYFECREKKTENSKVRKVKYEETVFYGLQYILNKYLKGKVVTK
EKIQEAKEVYKEHFQDDVFNEKGWNYILEKYDGHLPIEVKAVPEGSVIPRGNVLFTVENT
DPECYWLTNWIEVLDILGKKFPVTENSKGYKLLPPYLRVIQGDGVDINTLQEIVEGMKQK
KWSIENVAFGSGGALLQKLTRDLLNCSFKCSYVVTNGLGINVFKDPVADPNKRSKKGRLS
LHRTPAGNFVTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEVRKNAQLNIELEAAPH
Download sequence
Identical sequences G5BI30
HGL_H00000222553-4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]