SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000222792 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000222792
Domain Number 1 Region: 274-468
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 8.04e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.00000000495
Further Details:      
 
Domain Number 2 Region: 24-159
Classification Level Classification E-value
Superfamily SH2 domain 6.06e-27
Family SH2 domain 0.0000000867
Further Details:      
 
Domain Number 3 Region: 204-268
Classification Level Classification E-value
Superfamily Cysteine-rich domain 8.22e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000369
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000222792
Sequence length 468
Comment CHN2 (Homo_sapiens) chimerin (chimaerin) 2
Sequence
MAASSNSSLSGSSVSSDAEEYQPPIWKSYLYQLQQEAPRPKRIICPREVENRPKYYGREF
HGIISREQADELLGGVEGAYILRESQRQPGCYTLALRFGNQTLNYRLFHDGKHFVGEKRF
ESIHDLVTDGLITLYIETKAAEYISKMTTNPIYEHIGYATLLREKVSRRLSRSKNESRKT
SVTNEEHTPVEKISSLVRRAALTHNDNHFNYEKTHNFKVHTFRGPHWCEYCANFMWGLIA
QGVRCSDCGLNVHKQCSKHVPNDCQPDLKRIKKVYCCDLTTLVKAHNTQRPMVVDICIRE
IEARGLKSEGLYRVSGFTEHIEDVKMAFDRDGEKADISANIYPDINIITGALKLYFRDLP
IPVITYDTYSKFIEAAKISNADERLEAVHEVLMLLPPAHYETLRYLMIHLKKVTLNEKDN
FMNAENLGIVFGPTLMRPPEDSTLTTLRDMRYQKLIVQILIENEDVLF
Download sequence
Identical sequences G5C2B1
XP_004839550.1.39548 HGL_H00000222792

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]