SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000222956 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000222956
Domain Number 1 Region: 20-78
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000502
Family Canonical RBD 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000222956
Sequence length 92
Comment HNRNPA1P4 (Homo_sapiens) heterogeneous nuclear ribonucleoprotein A1 pseudogene 4
Sequence
MCTLPHKVDGDVVEPKKRTVREDSVKPGAHLTVKKICVSGIKEDTEEANLRDDFEKYGKI
EIIEVMEDRQSGKKSEFASDDCDTLDKIVVQK
Download sequence
Identical sequences G5B705
HGL_H00000222956

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]