SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000223073 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000223073
Domain Number 1 Region: 111-200
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.24e-25
Family Canonical RBD 0.0028
Further Details:      
 
Domain Number 2 Region: 4-90
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.76e-20
Family Canonical RBD 0.0027
Further Details:      
 
Domain Number 3 Region: 327-420
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.06e-20
Family Canonical RBD 0.00000926
Further Details:      
 
Domain Number 4 Region: 483-587
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000322
Family Canonical RBD 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000223073
Sequence length 758
Comment RBM28 (Homo_sapiens) RNA binding motif protein 28
Sequence
MAGLTLFVRNLPPSARSEQLEELFSQVGPVKQCFVVTEKGSKACRGFGYVTFSMLEDVQR
ALKEITTFEGSKINITVAKKKLRNNSKEKRKNENSESPKKELKTKKAKVADKKARLIIRN
LSFKCSEDDLKTVFSQFGAVLEVNIPRKPDGKMRGFAFVQFKNLLEAGKALKGMNMKDIK
GRTVAVDWAVAKDKYKNTQSVSAPGEEKCFELKHQGSVKKNGRAEEKEDNDGDVDVGVDS
DDGDSDEDEEKEENKESKVTKHVHVQKRAVKRAFPVESSDEDDSHEDTDLEERGSIDSEE
ELVPSDSSAEEQEDKDVRISKKKKKLPSDVSEGKTVFIRNLSFDSEEEEVGELLQQFGAL
KYVRIVLHPDTEHSKGCAFAQFMTQEATQKCLAAASPETEGGGLKLNGRQLKVDLAVTRD
EAAKLQTKKVKKPTGTRNLYLAREGLIRAGTKAAEGVSAADMAKRERFELLKHQKLKDQN
IFVSQTRLCLHNLPKAVDDKQLRKLLLNATRGEKGVHIKECRVMRDLKGVHGNMKGQSLG
YAFAEFQEHEHALRALRHINNNPEVFGPHKRPIVEFSLEDRRKLKMKELRIQRSLQKMKS
KAATGEPQKQKKEPVKEKQQKAAQNHTQDQSKGPPRQKGKMGSTSWTGFQTKAEVEQVEL
PDGKKRRKVLALPSHRGPKIRLRDKGKVKSLPPKEPKPQIKQWKQEKQQQSSKQVPRKKA
KGNKIEAHFNQLVERYKQKLLGPSKGAPLAKRSKWFDS
Download sequence
Identical sequences G5BHA3
HGL_H00000223073 XP_004856456.1.39548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]