SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000223210 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000223210
Domain Number 1 Region: 411-458
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 7.19e-18
Family KRAB domain (Kruppel-associated box) 0.0018
Further Details:      
 
Domain Number 2 Region: 93-123
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.000000275
Family KRAB domain (Kruppel-associated box) 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000223210
Sequence length 463
Comment ZNF862 (Homo_sapiens) zinc finger protein 862
Sequence
MPHGLGEVAAIKLLACTTLVPAQRLCALGEYYYPPTYARVKLPAALPARLGALSSGSPGP
PVGRGGSTLRPGRGGRGSTGRESGAMERRESGKAPVTFDDITVYLLQEEWLLLSQQQKDL
CGSDKLVAPLGATVAGPNLFGEFGRGSKPWVGDIHSQRSLLGHHSGKNQVGYMKKMDAEN
LAQDSGPYLPPLKKACLVPSSPEGDTIEGDWTGRSKKPRSIQKSWFVQFPWLIMNEEQTA
LFCSACRAYPSVRDKRSRLIEGYTGPFKVETLKYHAKSKAHLFCVNALAARDPIWAARFR
SIRDGSAGVLAGTEHLFPVNYPMFYPPEPLGDFDKMTKLLPSSRAELEDPERSTAIPALY
LDCIADLRQKEISGDSHNSSNINILGDNTIEFCRQGPAEEGLLEVPVVLEKLPAMFEDVA
VYFTREEWGLLDKQQKELYRNVMQMNYELLASLGKAPICATIT
Download sequence
Identical sequences G5AML4
HGL_H00000223210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]