SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000223459 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000223459
Domain Number 1 Region: 25-82
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-21
Family KRAB domain (Kruppel-associated box) 0.0024
Further Details:      
 
Domain Number 2 Region: 180-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000439
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000223459
Sequence length 275
Comment ZNF688 (Homo_sapiens) zinc finger protein 688
Sequence
MAPPPGRLLLAPRPGDTQPGRGKPGAVKFADVAVYFSPEEWGCLRPAQRALYRDVMRETY
GLLSALGFPGPKPALISWMEQESEAWSSAAQDPEEGESLVGALKGTPPRKEEPEGEPGEK
GPGVTPEKELPEELDNHSPDSSVSTVSAASQPPTKAAWGQMAVAQPPVPAATGDAQDNQR
RHVCADCGRRFTYPSLLVSHRRMHSGERPFPCPECGMRFKRKFAVEAHQWIHRSCSGGRR
GRRPGIRAVPRAPVRGDRDPPVLFRHYPDIFKECG
Download sequence
Identical sequences G5BYL1
HGL_H00000223459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]