SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000225899 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000225899
Domain Number 1 Region: 255-326
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 8.2e-23
Family Intermediate filament protein, coiled coil region 0.0012
Further Details:      
 
Domain Number 2 Region: 372-435
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.0000000549
Family Intermediate filament protein, coiled coil region 0.0053
Further Details:      
 
Domain Number 3 Region: 15-48
Classification Level Classification E-value
Superfamily Intermediate filament protein, coiled coil region 0.000000136
Family Intermediate filament protein, coiled coil region 0.0027
Further Details:      
 
Weak hits

Sequence:  HGL_H00000225899
Domain Number - Region: 15-157
Classification Level Classification E-value
Superfamily Tropomyosin 0.0615
Family Tropomyosin 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000225899
Sequence length 445
Comment KRT32 (Homo_sapiens) keratin 32
Sequence
MGSYTRWPEVSYIQNDRETLQFLNERLASYLDRVRLLERENEELEKHLREASQQQPPMGK
SPDYQPYFRTIEELQQKVLLTKADNTRLLVHIDNAKLAADDFRTKYETELSLRQLVESDI
NGLRRILDELTLCKSDLEAQVESLREELLCLKRSHEEEVAELRSQLGDHLDIEVAAAPPA
DLASMLEEMRRQYEAVVEAKHRDVEQWFSTQTEELSQQVATSSVQLQNYQSDIIDLKRTA
NTLEIELKAQSSLGDSLENTLTETEAHYGSQLAQMQGLIGNVEAQLAEIRADLERQNQEY
QVLLDVRARLECEINTYRGLLDSEDCKTITPEGSEENRVRKVGRGPRCCAGSRAGRVAVR
AQETAGLWPPRDSLDNMLAETEAHQLSQMQGMIINVELQHAEIQADPEQQNQEYQVLLDV
WAWFQDKINMYQGILAYLGARQVEI
Download sequence
Identical sequences G5B0N3
HGL_H00000225899

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]