SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000225941 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000225941
Domain Number 1 Region: 281-340
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-18
Family SH3-domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000225941
Sequence length 343
Comment ABI3 (Homo_sapiens) ABI family, member 3
Sequence
XQLQDFEIPAGREALRGNHAALLRVADFCEDNYVQATDKRKALEETMAFTTQALASVAYQ
VGNLAGHTLRMLDLQGTALRQVEARVSALGQMVNMHLEKVARREIGTLAAVQRLYPGQKV
LAPESLAPPPPYCRRPINFSCLDHVGHGIKVQRGALPPQSLRSSPFGCLRQHHAESRQAS
NSQRSFCLSLLGTDTACATTPSAPHVLIPACNPLPWLSPRSPNPSTAPPCAPPVALGGHG
LRRSYSPVSVPAELPPPLTPELEDLGLPPPPPGFGLEEPSWAPDAYLEKVVTLYPYTRQK
DNELSFTEGTIICVTRRYSDGWWEGVSAEGAGFFPGNYVVPGC
Download sequence
Identical sequences HGL_H00000225941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]