SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000226105 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000226105
Domain Number 1 Region: 1-184
Classification Level Classification E-value
Superfamily Mog1p/PsbP-like 4.13e-57
Family Ran-binding protein mog1p 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000226105
Sequence length 186
Comment RANGRF (Homo_sapiens) RAN guanine nucleotide release factor
Sequence
MEPTKASPLFGGAFSAIFPRGAIDVSDLRPVPDNQEVFCHPRTDQSLIVELLELQAHVQG
EAAARYHFEDVGRVQGSRVLQVESVQPLNLENLALRGCCQEAWVLSGKQQVAKENQQVAK
DVTLHQALLRVPRYQTDLLVTFNQPPPDHRSSLGPENLSSPSWNLGDFEQLVTSLTLHDP
NIFGPQ
Download sequence
Identical sequences A0A0P6JC17
XP_004857548.1.39548 HGL_H00000226105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]