SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000226207 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000226207
Domain Number 1 Region: 412-820
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.01e-140
Family Motor proteins 0.00000000000186
Further Details:      
 
Domain Number 2 Region: 57-411
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.96e-125
Family Motor proteins 0.0000000000307
Further Details:      
 
Domain Number 3 Region: 818-937
Classification Level Classification E-value
Superfamily Myosin rod fragments 5.1e-27
Family Myosin rod fragments 0.00000174
Further Details:      
 
Domain Number 4 Region: 1213-1331
Classification Level Classification E-value
Superfamily Myosin rod fragments 6.02e-27
Family Myosin rod fragments 0.0046
Further Details:      
 
Domain Number 5 Region: 940-1049
Classification Level Classification E-value
Superfamily Myosin rod fragments 1.02e-24
Family Myosin rod fragments 0.0013
Further Details:      
 
Domain Number 6 Region: 1408-1530
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00000000000000314
Family Myosin rod fragments 0.0059
Further Details:      
 
Domain Number 7 Region: 1048-1161
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000523
Family Myosin rod fragments 0.005
Further Details:      
 
Weak hits

Sequence:  HGL_H00000226207
Domain Number - Region: 1684-1884
Classification Level Classification E-value
Superfamily Tropomyosin 0.000144
Family Tropomyosin 0.0015
Further Details:      
 
Domain Number - Region: 1330-1407
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.027
Family Myosin rod fragments 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000226207
Sequence length 1887
Comment MYH1 (Homo_sapiens) myosin, heavy chain 1, skeletal muscle, adult
Sequence
MSSDSEMAVFGEAAPFLRKSEKERIEAQNKPFDAKTSVFVVDAKESFVKATVQSREGGKV
TAKTEGGATVTVKDDQVYPMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSG
LFCVTVNPYKWLPVYNAEVVTAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGE
SGAGKTVNTKRVIQYFATIAVTGEKKKEEQTSGKMQGTLEDQIISANPLLEAFGNAKTVR
NDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQIMSNKKPDL
IEMLLITTNPYDYAFVSQGEITVPSIDDQEELMATDSAIYKLTGGVMHYGNMKFKQKQRE
EQAEPDGTEVADKAAYLQSLNSADLLKALCYPRVKVGNEYVTKGQTVQQAIADKAAYLQS
LNSADLLKALCYPRVKVGNEYVTKGQTVEQVTNAVGALGKAVYEKMFLWMVTRINQQLDT
KQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWE
FIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLYEQHLGKSNNFQKPKPT
KGKTEAHFSLIHYAGTVDYNIVGWLDKNKDPLNETVVGLYQKSSMKTLAYLFSGAAAAAE
AGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYADFKQRYKVLNASAIPEGQFIDSKK
ASEKLLGSIDIDHTQYKFGHTKVFFKAGLLGLLEEMRDDKLAQLITRTQAMCRGFLARVE
YQKMVERRESVFCIQYNVRAFMNVKHWPWMKLYFKIKPLLKSAETEKEMATMKEEFEKTK
ESLAKAEAKRKELEEKMVALMQEKNDLQLQVQAEADSLADAEERCDQLIKTKIQLEAKIK
EVTERAEDEEEINAELTAKKRKLEDECSELKKDIDDELTLAKVEKEKHATENKVKNLTEE
MAGLDETIAKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKAKVKLEQQVDDLEGSLEQE
KKIRMDLERAKRKLEGDLKLAQESTMDIENDKQQLDEKLKKKEFEMSNLQSKIEDEQALG
MQLQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQI
EMNKKREAEFQKMRRDLEEATLQHEATAATLRKKHADSVAELGEQIDNLQRVKQKLEKEK
SEMKMEIDDLASNMETVAKAKGNLEKMCRTLEDQLSELKTKEEEQQRMINELTAQRARLQ
TESGEYSRQLDEKDSLLSQLSRGKQAFTQQIEELKRQLEEEIKAKSALAHALQSSRHDCD
LLREQYEEEQEAKAELQRAMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAE
EHVEAVNAKCASLEKTKQRLQNEVEDLMIDVERTNAACAALDKKQRNFDKILAEWKQKYE
ETHAELEASQKESRSLSTELFKVKNAYEESLDQLETLKRENKNLQQEISDLTEQIAEGGK
RIHELEKIKKQVEQEKTELQAALEEAEASLEHEEGKILRIQLELNQVKSEIDRKIAEKDE
EIDQLKRKKMEGDLNEMEIQLNHANRMAAEALRNYRNTQGILKDTQLHLDDALRGQEDLK
EQLAMVERRANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKK
KLETDISQIQGEMEDIVQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQ
TVKDLQHRLDEAEQLALKGGKKQIQKLEARVRELEGEVEGEQKRNVEAVKGLRKHERRVK
ELTYQTEEDRKNILRLQDLVDKLQSKVKAYKRQAEEAEEQSNVNLSKFRKIQHELEEAEE
RADIAESQVNKLRVKSREVHTKIISEE
Download sequence
Identical sequences G5B5I3
HGL_H00000226207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]