SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000226209 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000226209
Domain Number 1 Region: 57-838
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.06e-290
Family Motor proteins 2.2e-17
Further Details:      
 
Domain Number 2 Region: 1235-1353
Classification Level Classification E-value
Superfamily Myosin rod fragments 2.53e-29
Family Myosin rod fragments 0.0024
Further Details:      
 
Domain Number 3 Region: 839-963
Classification Level Classification E-value
Superfamily Myosin rod fragments 3.53e-27
Family Myosin rod fragments 0.0000016
Further Details:      
 
Domain Number 4 Region: 957-1072
Classification Level Classification E-value
Superfamily Myosin rod fragments 3.92e-23
Family Myosin rod fragments 0.0011
Further Details:      
 
Domain Number 5 Region: 1430-1552
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000000000000102
Family Myosin rod fragments 0.0062
Further Details:      
 
Domain Number 6 Region: 1594-1837
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000000719
Family Tropomyosin 0.00082
Further Details:      
 
Weak hits

Sequence:  HGL_H00000226209
Domain Number - Region: 1069-1183
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00471
Family Myosin rod fragments 0.0073
Further Details:      
 
Domain Number - Region: 1808-1912
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00497
Family Myosin rod fragments 0.0094
Further Details:      
 
Domain Number - Region: 1353-1430
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0392
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000226209
Sequence length 1942
Comment MYH3 (Homo_sapiens) myosin, heavy chain 3, skeletal muscle, embryonic
Sequence
MSSDTEMEVFGIAAPFLRKSEKERIEAQNQPFDAKTYCFVVDSKEEYAKGKIKSTQDGKV
TVETEDNRTLVVKPEDVYAMNPPKFDRIEDMAMLTHLNEPAVLYNLKDRYTSWMIYTYSG
LFCVTVNPYKWLPVYNPEVVDGYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGE
SGAGKTVNTKRVIQYFATIAATGDLAKKKDAKMKGTLEDQIISANPLLEAFGNAKTVRND
NSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQILSNKKPELIE
LLLITTNPYDYPFISQGEILVASIDDAEELLATDSAIDILGFTPEEKSGLYKLTGAVMHY
GNMKFKQKQREEQAEPDGTEVADKTAYLMGLNSSDLLKALCFPRVKVGNEYVTKGQTVDQ
VHHAVNALSKSVYEKLFLWMVTRINQQLDTKLPRQHFIGVLDIAGFEIFEYNSLEQLCIN
FTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPMGIFSILEEECM
FPKATDTSFKNKLYDQHLGKSANFQKPKVVKGRAEAHFSLIHYAGTVDYSVSGWLEKNKD
PLNETVVGLYQKSSNRLLAHLYATFATADTDSGKKKVAKKKGSSFQTVSALFRENLNKLM
SNLRTTHPHFVRCIIPNETKTPGAMEHSLVLHQLRCNGVLEGIRICRKGFPNRILYGDFK
QRYRVLNASAIPEGQFIDSKKACEKLLASIDIDHTQYKFGHTKVFFKAGLLGTLEEMRDD
RLAKLITRTQAVCRGFLMRVEFQKMVQRRESIFCIQYNIRSFMNVKHWPWMKLFFKIKPL
LKSAETEKEMATMKAEFQKTKDELAKSEAKRKELEEKLVTLVQEKNDLQLQVQAESENLL
DAEERCDQLIKAKFQLEAKIKEVTERAEDEEELNAELTAKKRKLEDECSELKKDIDDLEL
TLAKVEKEKHATENKVKNLTEELAGLDETIAKLTREKKALQEAHQQTLDDLQAEEDKVNS
LSKIKSKLEQQVDDLESSLEQEKKLRVDLERNKRKLEGDLKLAQESILDLENDKQQLDER
LKKKDFEYSQLQSKVEDEQALGLQFQKKIKELQARIEELEEEIEAERATRAKTEKQRSDY
ARELEELSERLEEAGGVTSTQIELNKKREAEFLKLRRDLEEATLQHEATVAALRKKHADS
AAELAEQIDNLQRVKQKLEKEKSEFKLEIDDLSSSVESVSKSKANLEKICRTLEDQLSEA
RGKNEEIQRSVSELTTQKSRLQTEAGELSRQLEEKESIVSQLSRSKQAFTQQIEELKRQL
EEESKAKNALAHALQSSRHDCDLLREQYEEEQEAKAELQRVLSKANSEVAQWRTKYETDA
IQRTEELEEAKKKLAQRLQDSEEQVEAVNAKCASLEKTKQRLQGEVEDLMVDVERANSLA
TALDKKQRNFDKVLAEWKTKCEESQAELEASLKESRSLSTELFKLKNAYEEALDQLETVK
RENKNLEQEIADLTEQIAENGKTIHELEKSRKQMELEKADIQLALEEAEAALEHEEAKIL
RIQLELTQVKSEIDRKIAEKDEEIEQLKRNYQRTAETMQSALDAEVRSRNEAIRIKKKME
GDLNEIEIQLSHANRQAAETLKHLRSVQGQLKDTQLHLDDALRGQEDLKEQLAIVERRAN
LLQAEVEELQATLEQTERARKLAEQELLDSNERVQLLHTQNTSLIHTKKKLETDLTQLQS
EVEDASRDARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKTLEQTVKDLQHRLDE
AEQLALKGGKKQIQKLETRIRELEFELEGEQKKNTESVKGLRKYERRVKELTYQSEEDRK
NVLRLQDLVDKLQVKVKSYKRQAEEADEQANVHLTKFRKAQHELEEAEERADIAESQVNK
LRAKTRDFTSSRVSPRPGKNSQ
Download sequence
Identical sequences G5B5I5
HGL_H00000226209

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]