SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000226299-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000226299-1
Domain Number 1 Region: 125-351
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.26e-69
Family Leucine aminopeptidase, C-terminal domain 0.00000001
Further Details:      
 
Domain Number 2 Region: 3-114
Classification Level Classification E-value
Superfamily Macro domain-like 5e-22
Family Leucine aminopeptidase (Aminopeptidase A), N-terminal domain 0.0000028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000226299-1
Sequence length 351
Comment LAP3 (Homo_sapiens) leucine aminopeptidase 3
Sequence
MMKGLVLRVYSKDKEDDMPHFTSAGESFNKLVNGKLRDILNMSGPPLKTTKTNFPRVVLV
GLSKRTAGVDEQENWHEGKENIRAAVTEGCGQVQDLELSSVEVDPCGDAQAAAEEAAPMQ
MKHPWCFLGSGGISIKTPANMDLMRADVGGAATICSAIVSAAKLNLPINIIGLAPLCENM
PSGRANKPGDVVRAQNGKTIQVDNTDAEGRLILADVLCCAHTFNPKLIINAATLTGATDV
VLGPGATGVFTNSFWLWNKLFEASIKQGTMSGGWLSEYYTRKVVDCQLADVNNVGKYRSA
GACTAVKFLGEFVTHPKWAHLDIAGVMTNKDEVLSLCKGMTGRATRTLIEF
Download sequence
Identical sequences G5ANJ7
HGL_H00000226299-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]