SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000226574 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000226574
Domain Number 1 Region: 122-350
Classification Level Classification E-value
Superfamily p53-like transcription factors 1.65e-62
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000141
Further Details:      
 
Domain Number 2 Region: 607-825
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.97e-59
Family Ankyrin repeat 0.0000201
Further Details:      
 
Domain Number 3 Region: 346-474
Classification Level Classification E-value
Superfamily E set domains 1.38e-46
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000115
Further Details:      
 
Domain Number 4 Region: 874-954
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000188
Family DEATH domain, DD 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000226574
Sequence length 1164
Comment NFKB1 (Homo_sapiens) nuclear factor of kappa light polypeptide gene enhancer in B-cells 1
Sequence
MIPDIKLTALCKCPGDSRGAHPPAAAAAGTGGDQSFGAGSCQKVTGVQVLTCVRPQGFHS
VITALDSVTLHSVGLRVVSGWWWEGVDSSGPTQSPMQEQEPPRGCEVQENPSSLAAEEPT
DGPFLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKPTARMPQEQANRER
PSRTDAGGQCRAVNRCRRARSPEQQWRTRLVGKHCEDGVCTVTAGPKDMVTSFANLGILH
VTKKKVFETLETRMTDACIRGYNPGLLVHPDLAYLQAEGGGGDRQLTDREKELIRQAALQ
QTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIYDSKAPNASNLKIVRMDRTAGCV
TGGEEIYLLCDKVQKDDIQIRFYEEEENGGIWEGFGDFSPTDVHRQFAIVFKTPKYKDIN
ITKPASVFVQLRRKSDLETSEPKPFLYYPEIKDKEEVQRKRQKLMPNFSDSFGGGYGFPH
YGFPTYGGVAFHPGTTKSTTGMKHETVNTECDHDPAGCEACEDGEVIIAPELEEEAGAPS
PGTHRAPLTGAVRREDEGTRFPDNLFLEKALQLAKRHANALFDYAVTGDVKMLLAVQRHL
TAVQDENGDSILHLAVIHLHAQLVRDLLQVTAGVISEDIINMRNDLYQTPLHLAVITKQE
DVVEDLLQAGADLSLLDRLGNSALHLATKEGQDGILSILLKHRKAPPLLDHPNREGLNAI
HIAVTSNSLPCLLLLVAAGANVNAQEQKSGRTALHLAVEQDNVSLAGCLLLEGEAHVDST
TYDGTTALHIAAGRGSTRLAALLKAAGADPLVENFEPLCDLDESWERAGEDEGVVPGTTP
LDMAASWQVFDILNGKPYEPEITADDVLAQGDMKLLSEEAKLQLYKLLEVPDPDRNWATL
AHKLGLGILNHAFRLSPSPSKTLMDNYEVSGGTVKELVEALGQMGYTEAIEVVQAACCSS
GAPSPVKGTTQGPPPALSLSPKMGKDTGEAGRSCSLLAWGLRVSGDTEDRAVPTGTLCPS
RHRCSPEGAVTRTCELPSAPRPAGCDRELIPVGQIPKDTLPQREGCVLFRVDSLHQSPLI
FSATRNVVKVPFDGTGDGSGLRISSSSRSCIYELRDQDSICDSGVETSFRKLSFTESLTG
GSPLLTLNKGPPNFGQDGPIEGKI
Download sequence
Identical sequences G5BXA4
HGL_H00000226574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]