SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000228284 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000228284
Domain Number 1 Region: 102-580
Classification Level Classification E-value
Superfamily TPR-like 3.6e-61
Family HAT/Suf repeat 0.00066
Further Details:      
 
Domain Number 2 Region: 761-847
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.04e-23
Family Canonical RBD 0.0049
Further Details:      
 
Domain Number 3 Region: 680-758
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000000000457
Family Canonical RBD 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000228284
Sequence length 924
Comment SART3 (Homo_sapiens) squamous cell carcinoma antigen recognized by T cells 3
Sequence
MATAAATSASEPETEPKAGPKAEGEEDDVKAARRRRKVFSRAVATATYKTVGPGWDQQEE
CVSDSDVEECAEASSAESSPGEYEWEYDEEEEKNQLEIERLEEQLSINIYDYNCHVDLIR
LLRLEGELTKVRMARQKMSEIFPLTEELWLEWLHDEISMAMDGLDREHVYELFERAVKDY
ICPNIWLEYGQYSVGGIGQKGGLEKVRSVFERALSSVGLHMTKGLAIWEAYREFESAIVE
AARLEKIHSLFRRQLAVPLYDMEATFAEYEEWSDDPVPELVIQNYNKALQQLEKYKPYEE
ALLQAEAPRLAEYQAYIDFEMKIGDPARIQLIFERALVENCLVPDLWIRYSQYLDRQLKV
KDLVLSVHSRAVRNCPWTVALWSRYLMAMERHGVDHGEISVTFEKALNAGFIQATDYVEI
WQAYLDYLRRRVDFGQDSSKELEELRTAFTRALEYLQQEVEERFNESGDPSCMIMQNWAR
IEARLCNNMQKARELWDNIMTKGNAKYANMWLEYYNLERAHGDTQHCRKALHRAVQCTSD
YPEHVCEVLLTMERTEGTLEDWDVAVQKTETRLARVREQRMKAAEKEAALVQQEEEKAEQ
RKRVRAEKKALKKKKKPRGADKPREEEDEKEWGDADGEQPAKRRRLENSVAPGGPAAGME
EDTGLAGKNAAVDVETPSKQKEKAAALKRDMPKVPHDSSKDSITVFVSNLPYSMVEPEVK
LRPLFEACGEVAEIRPIFSNRGDFRGYCYVQFKDENTALEKHKLFISGLPFSCTKEELED
ICKAHGTVKELRLVTNRAGKPKGLAYVEYENESQASQAVMKMDGMTIKENVIKVAISNPP
QRKVPEKPEVRKAPGGPLVPRQMYGARGKGRTQLALLPRALQRPTTASVQAENGPSPHPA
GATSTASEAPKMSNADFAKLLLRK
Download sequence
Identical sequences G5AWZ8
HGL_H00000228284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]