SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000228289 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000228289
Domain Number 1 Region: 388-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-21
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 612-669
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.61e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 276-333
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.9e-21
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 4 Region: 556-613
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.2e-21
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 5 Region: 445-501
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.22e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 668-725
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.17e-20
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 7 Region: 724-781
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.21e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 333-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.1e-20
Family Classic zinc finger, C2H2 0.0087
Further Details:      
 
Domain Number 9 Region: 501-557
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-19
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 10 Region: 220-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.19e-19
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 11 Region: 770-822
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-17
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 12 Region: 1-40
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.62e-17
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 13 Region: 143-193
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.56e-17
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 14 Region: 66-116
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000707
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 15 Region: 183-215
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000653
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000228289
Sequence length 824
Comment ZNF10 (Homo_sapiens) zinc finger protein 268
Sequence
VTFEDVAVTFTVEEWALLNPSQKQLYRDVMRETFRNMAAIAEDLACRKPLVGHLSLNEPI
IAHTVLKTSEYLGLEEKLYKCNEYGRTCGDLQSFQKDTRTKTGEKPYEYDQCGKSYPDLN
ERTHFKETFAYKKNLKASTLNDVQILERSHNAGKPYVCKQCGKAFSTQSNCKIHERLHTG
KKPYVCKQCGKAFSTQGYCKKHERTHRREKPYVCKQCRKAFSTQRYCKIHERIHTGEKPY
VCKQCGKGFSTQDYCKIHERNHAREKPYVCKQCGKAFSTQDYWKRHERTHTGEKPYKCKQ
CGKAFSIRGTCQRHERSHIGEKPYVCKQCGKPFSTQSHCKIHERIHTGEKPYVCKQCGKG
FSTQGYCKIHERNHAREKPYVCKQCGKAFSTQDYCKIHERNHTGEKPYVCKQCGKAFSTQ
SHCKVHERIHTGEKPYVCKQCGKAFGTLKICKQHERTHTGEKPYKCKQCGKAFNTQGYCK
IHERTHTGEKPYVCKQCGKAFGTLKICKQHERTHIGEKPYVCKQCGKSFTTQGYCKIHER
LHTGEKPYVCKQCGKAFNKHVHCKEHERTHTGEKPYVCKQCGKAFNRYSYCQIHERTHTG
EKPYVCKQCGKAFSKRDYCQIHERIHTGEKPYVCKQCGKAFGTQSHCKIHERIHTGEKPY
VCKQCGKAFSTKGHCRKHERTHTGEKPYICEQCGKAFSTQRYCKIHEKSHTGENPYVCKQ
CGKAFFTSSKCQRHERIHTGEKPYVCKQCGKAFSTHDDCQRHESTHSKEKPYVCKQCGKA
FFTSSKCQRHERIHTGEKPYICKQCGKAFNTDGGCKRHERTHTR
Download sequence
Identical sequences G5BQ34
HGL_H00000228289

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]