SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000228567-1 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000228567-1
Domain Number 1 Region: 301-413
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 6.83e-34
Family Synaptotagmin-like (S variant) 0.0000913
Further Details:      
 
Domain Number 2 Region: 440-538
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.34e-29
Family Synaptotagmin-like (S variant) 0.0000735
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000228567-1
Sequence length 593
Comment SYT10 (Homo_sapiens) synaptotagmin X
Sequence
MVPDVKISLQQEQDTNDQGAELLLALRRKVFWATVQPSPSAEEQSCPQQLQGPARAPKVA
APERTGTADGEEARGRRAEPTENFHKEDRVSSLCQKALHIVTELCFSGQVEWEKCSGIFP
LESGSRAKGSTDIFFSLLAVISFCGLALLVVSLFVFWKWCWPCWKSKAVTPNVSILPQSI
SRAPTEVFEAEEKKEVKENGKPALKALEPAIKISHTSDIPAEVQTALKVHLIKHAHVQRQ
TTEPTSSSRHNSFRRQMQVSSVDFTMDVEPVLQRGETTTSIGRIKPELYKQKSVDSEGNR
TENVKTCGKLNFTLQYDYEKNELLVVKIIKALDLPEKDFTGTSGPHVKTYLLPDRKKKFQ
THVHRKTLNPLFDEAFQFPVVYDQLSNRKLHFSVYDFDRFSRHDMIGEVILDNLFEVSDL
SREATVWKDIHCATTESIDLGEIMFSLCYLPAAGHMILTVIKCRNLKAMDITGSSDLYVK
VSLICEGRRLKKRKTAIKKNTLNPVYNEAIIFDIPLENMDQVSLTIAVMDYDREGHHTLA
PLLEELWNSHVFVSENTRRTLFSPNRMFRELPGRATSFDSQGSCSSPKPPSTP
Download sequence
Identical sequences G5AU94
HGL_H00000228567-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]