SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000228820 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  HGL_H00000228820
Domain Number 1 Region: 123-262
Classification Level Classification E-value
Superfamily ADP-ribosylation 5.25e-39
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.025
Further Details:      
 
Domain Number 2 Region: 17-103
Classification Level Classification E-value
Superfamily WWE domain 8.63e-17
Family WWE domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000228820
Sequence length 263
Comment PARP11 (Homo_sapiens) poly (ADP-ribose) polymerase family, member 11
Sequence
MFHKTEEFMSKTTEGGMDDMDTSDTQWGWFFLAECGKWHMFQPDANIQCSVSSEDIEKSF
KTNPYGSISFTTSKFSYKIDFAEMKQTNLTTGKQRSIKRGPFSITAFRKKAQLKKKRGVP
QINEQMLFHGTSSEFVEAICIHNFDWRINGVHGAVFGKGTYFARDASYSSRFCKDDVKHG
NTFQIHGVSLPQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKDGSYVNLYDSCVDDT
WNPKVFVVFDANQIYPEYLIDFH
Download sequence
Identical sequences G5AS07
HGL_H00000228820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]