SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for HGL_H00000229214-3 from Heterocephalus glaber v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  HGL_H00000229214-3
Domain Number - Region: 36-89
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.000209
Family Eukaryotic type KH-domain (KH-domain type I) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) HGL_H00000229214-3
Sequence length 219
Comment KRR1 (Homo_sapiens) KRR1, small subunit (SSU) processome component, homolog (yeast)
Sequence
MNFAARNRSKRTEHINATLDLIEGSMTVCTSKKTFDPYIIIRGNTVSAIGPFSGLKEVRK
VVLDTMKNIHPIYYIKTLMIKRELAKDSELRSQSWERFLSQFKHKNVNKRKEPKKKTVKK
EYTPFPPPQPESQVDKELASGEYFLKANQKKRQKMEAIKAKQAEALSKRQEERNKAFIPP
KEKPVAKSKEASTETKIDVATIKEKVKKAKNKKLEALTT
Download sequence
Identical sequences G5C0Z4
HGL_H00000229214-3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]